Analytical Data
-
Gene name
GJb6
- Application
-
Alternative Names
GJb6；Gap junction beta-6 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95452
-
Expression Region
1-261aa
-
AA Sequence
MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIEDIKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS
-
Molecular Weight
30.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GJb6, also known as connexin 30.3, is a member of the gap junction protein family and is crucial in cell communication and tissue homeostasis. Research into GJb6 has gained momentum due to its significant role in various physiological and pathological processes, particularly in the nervous system and skin. Disruptions in GJb6 function have been implicated in several diseases, including skin disorders and neurodegenerative conditions, highlighting its potential as a therapeutic target. Furthermore, GJb6's involvement in forming gap junction channels allows for the exchange of ions and small molecules between adjacent cells, which is essential for maintaining cellular metabolism and signaling. Understanding the structural and functional properties of GJb6 through recombinant protein studies can provide insights into its mechanisms of action and interactions with other proteins. This knowledge is vital for developing strategies to manipulate GJb6 function in disease models, paving the way for innovative treatments that could restore normal cell communication and function in affected tissues. Overall, research on GJb6 recombinant protein is essential for unraveling its biological significance and potential clinical applications.
