Cat: PA1000-1851

Recombinant Human LUM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LUM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LUM;LDC;SLRR2D;Lumican

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51884

  • Expression Region

    1-338aa

  • AA Sequence

    MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSA MYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHN LLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKIT KLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNS FNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

  • Molecular Weight

    63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LUM (Lumican) is a small leucine-rich proteoglycan primarily found in the extracellular matrix of connective tissues, playing a crucial role in cellular processes including cell growth, migration, and tissue organization. Its significance in the regulation of collagen fibrillogenesis has made it a focal point in research related to various pathological conditions such as fibrosis, cancer, and cardiovascular diseases. Understanding LUM's structure and function, particularly through the study of recombinant protein, offers valuable insights into its biological mechanics and therapeutic potential. The production of LUM as a recombinant protein allows for the detailed investigation of its interactions with other extracellular matrix components and cell surface receptors, facilitating a deeper understanding of its role in health and disease. Moreover, given the emerging interest in extracellular matrix components as targets in regenerative medicine and tissue engineering, studying LUM provides opportunities to develop novel therapeutic strategies aimed at modulating its activity to improve tissue repair and regeneration. This ongoing research underscores LUM's relevance not only as a biomarker for certain diseases but also as a potential target for innovative treatments, highlighting the importance of thorough scientific exploration in the field of proteoglycans and their complex roles in human physiology. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US