Analytical Data
-
Gene name
U24
- Application
-
Alternative Names
U24；E3 ubiquitin-Protein ligase Itchy homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9QJ42
-
Expression Region
1-88aa
-
AA Sequence
MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK
-
Molecular Weight
16.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
U24 recombinant protein has garnered significant attention in recent years due to its potential applications in both therapeutic and diagnostic fields. U24 is a key viral protein associated with various pathogens, particularly in the context of infectious diseases. Its ability to elicit immune responses makes it a promising candidate for vaccine development. Researchers have focused on the structure and function of the U24 protein to understand its role in viral pathogenesis and immune evasion mechanisms. The production of U24 as a recombinant protein allows for detailed studies on its biochemical properties, immunogenicity, and interactions with host systems. By employing techniques such as molecular cloning, expression in suitable host organisms, and purification, scientists aim to generate U24 protein in sufficient quantities for comprehensive research. This research is crucial not only for the development of effective vaccines but also for the production of diagnostic tools that can detect viral infections early and accurately. As the global landscape of infectious diseases continues to evolve, the study of U24 recombinant protein represents an essential step towards enhancing our understanding of viral biology and improving public health measures.
