Analytical Data
-
Gene name
SAT1
- Application
-
Alternative Names
SAT1；SAT;Diamine acetyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21673
-
Expression Region
5-171aa
-
AA Sequence
VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
-
Molecular Weight
26.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAT1 (Spermidine/Spermine N1-acetyltransferase 1) is an important enzyme involved in polyamine metabolism, which plays a crucial role in cellular processes such as growth, differentiation, and apoptosis. As polyamines are vital for cellular function, the study of SAT1 has gained significant interest, particularly in the context of cancer biology and neurodegenerative diseases. Elevated levels of polyamines have been associated with tumor development and progression, making SAT1 a potential biomarker and therapeutic target in oncology. Additionally, SAT1 is implicated in the regulation of inflammation and stress response, linking it to various physiological and pathological conditions. Understanding the structure and function of SAT1, including its reactivity and interactions with other biomolecules, is essential for developing novel therapeutic strategies. Research into SAT1’s recombinant protein has advanced, utilizing techniques such as molecular cloning and protein expression to generate functional variants for study. These recombinant proteins facilitate in-depth investigations into enzymatic activity, regulation, and the effects of post-translational modifications, providing insights into their role in health and disease. Overall, the exploration of SAT1 and its recombinant forms is poised to enhance our understanding of polyamine biology and its implications in various diseases, paving the way for innovative treatments.
