Analytical Data
-
Gene name
CNTF
- Application
-
Alternative Names
CNTF;Ciliary neurotrophic factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26441
-
Expression Region
2-200aa
-
AA Sequence
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLD SADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPT EGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNTF (Ciliary Neurotrophic Factor) is a member of the interleukin-6 family of cytokines and plays a crucial role in the survival, differentiation, and maintenance of various neuronal populations in the central and peripheral nervous systems. Given its neuroprotective properties, CNTF has garnered significant attention for its potential therapeutic applications in neurodegenerative diseases, such as amyotrophic lateral sclerosis (ALS) and multiple sclerosis (MS). The recombinant form of CNTF has been developed to explore its biological functions and therapeutic efficacy. Early studies demonstrated that CNTF can promote neuronal survival and regeneration, making it a candidate for treating conditions associated with neuronal damage. However, the clinical application of CNTF has faced challenges, such as achieving adequate delivery to target cells and mitigating side effects. Recent advances in biotechnology have facilitated the production of recombinant CNTF with enhanced stability and bioactivity, leading to a better understanding of its mechanisms of action. Research has also focused on optimizing CNTF formulations and delivery methods to improve its therapeutic index. The ongoing investigations into CNTF’s roles in neural repair and its impact on various neurological disorders underscore its potential as a valuable tool in regenerative medicine and highlight the importance of continued research in unlocking its full therapeutic capabilities.
