Analytical Data
-
Gene name
CNPY3
- Application
-
Alternative Names
CNPY3；CTG4A；ERDA5；PRAT4A;Protein canopy homolog 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BT09
-
Expression Region
31-278aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSGPSQAGAEENDWVRLPSKCEVCKYVAV ELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRL LDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSA EVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCL AEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPS PEEDEGIQKASPLTHSPPDEL
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNPY3, a member of the CNPY (cysteine-rich non-typical secretory protein) family, has garnered significant attention in recent years due to its potential roles in various biological processes and diseases. Originally identified in the context of cardiovascular development, CNPY3 is believed to play a crucial role in cell signaling and regulation. Recent studies have suggested that CNPY3 may be involved in neurodegenerative diseases, as its expression levels vary in neurological disorders. Furthermore, its interaction with cellular pathways related to stress responses and apoptosis underscores its importance in maintaining cellular homeostasis. The recombinant expression of CNPY3 protein allows researchers to explore its structural and functional characteristics in detail, facilitating the understanding of its mechanisms of action. This knowledge is vital for elucidating the pathological roles of CNPY3 in disease contexts, paving the way for potential therapeutic applications. By studying the biochemical properties and interactions of CNPY3 through recombinant protein techniques, researchers aim to uncover its contribution to cellular functions and its potential as a biomarker or therapeutic target in diseases such as cancer and neurodegeneration. The ongoing research on CNPY3 not only enhances our understanding of its biological significance but also opens new avenues for innovative treatments that could emerge from a deeper comprehension of its mechanisms.
