Analytical Data
-
Gene name
CGB
- Application
-
Alternative Names
CGB;CGB;CGB5;CGB8;Choriogonadotropin subunit beta 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05060
-
Expression Region
328-677aa
-
AA Sequence
HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
-
Molecular Weight
73.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CGB (chorionic gonadotropin beta) recombinant protein research has garnered significant interest due to its pivotal role in reproductive biology and potential therapeutic applications. CGB is a glycoprotein hormone primarily produced in the placenta during pregnancy, and it is crucial for maintaining luteal function and supporting fetal development. The study of CGB has broad implications, particularly in understanding gestational processes, fertility treatments, and various pregnancy-related disorders. Recombinant technology allows scientists to produce CGB in a more controlled and efficient manner, facilitating detailed investigations into its structure, function, and interactions within the endocrine system. Furthermore, the expression of CGB can lead to advancements in diagnostics for pregnancy assessment and the development of novel biopharmaceuticals aimed at addressing reproductive health issues. As researchers continue to explore the potential of CGB, its application in assisted reproductive technologies and hormone replacement therapies could significantly impact clinical practices in obstetrics and gynecology, making it a critical focus in modern biomedical research.











