Cat: PA1000-9230

Recombinant Human FBLN3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBLN3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FBLN3;FBLN3;FBNL;EGF-containing fibulin-like extracellular matrix Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12805

  • Expression Region

    1-493aa

  • AA Sequence

    MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVGQQCKDIDECDI VPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTG VVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIP SNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQ CPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNY TCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSI RSDRSVPSDIFQIQATTIYANTINTFRIKSGSENGEFYLRQTSPVSAMLV LVKSLSGPREHIVDLEMLTASSIGTFRTSSVLRLTIIVGPFSF

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBLN3, or fibulin-3, is a member of the fibulin family of extracellular matrix proteins, which play critical roles in tissue development, maintenance, and repair. The research on FBLN3 has gained momentum due to its implications in various pathological conditions, particularly in cancer and fibrotic diseases. Studies have shown that FBLN3 is involved in modulating cell adhesion, migration, and proliferation through its interactions with various extracellular matrix components and cell surface receptors. Additionally, aberrant expression of FBLN3 has been linked to tumor progression and metastasis, highlighting its potential as a diagnostic and therapeutic target. Recent advances in recombinant protein technology have facilitated the production of FBLN3 in a tractable format, allowing researchers to investigate its structure-function relationships and biological activities in greater detail. Understanding the specific mechanisms by which FBLN3 influences cell behavior could provide insight into its role in disease progression and open avenues for developing novel therapeutic strategies. Overall, the study of recombinant FBLN3 protein is essential for unraveling its biological functions and therapeutic potential, making it a significant focus in biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US