Analytical Data
-
Gene name
SOCS2
- Application
-
Alternative Names
SOCS2；CIS2；SSI2；STATI2；Suppressor of cytokine signaling 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14508
-
Expression Region
1-198aa
-
AA Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYW GSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQ DGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHL YLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOCS2 (Suppressor of Cytokine Signaling 2) is a member of the SOCS family, which plays a crucial role in regulating cytokine signaling pathways and maintaining immune homeostasis. It acts as a negative feedback regulator for various cytokines, including growth hormone, leptin, and interleukins, thus influencing critical physiological processes such as metabolism, growth, and inflammation. Aberrant SOCS2 expression has been linked to several diseases, including obesity, metabolic disorders, and cancers, making it a significant target for therapeutic intervention. The reconstitution of SOCS2 protein offers the potential for extensive research into its structural and functional characteristics, enabling insights into its specific mechanisms of action. This recombinant protein can be utilized in various experimental settings to study its interactions with other signaling molecules, assess its role in immune response modulation, and investigate its potential as a therapeutic agent in conditions associated with SOCS2 dysregulation. Understanding the functional role of SOCS2 through recombinant protein studies is essential for developing effective strategies to harness its signaling pathways for therapeutic purposes.
