Analytical Data
-
Gene name
CCR9
-
简介
CCR9 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
- Application
-
Alternative Names
chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9;
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51686-1
-
Expression Region
M1-L369
-
AA Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR9 (C-C chemokine receptor type 9) is a chemokine receptor predominantly expressed in the immune system, particularly in T cells. It plays a crucial role in immune responses by mediating the migration of leukocytes to sites of inflammation and is involved in various pathological conditions, including inflammatory bowel disease (IBD) and certain types of cancer. The receptor's specific ligand, CCL25 (also known as TECK), is primarily produced in the intestines, highlighting the importance of CCR9 in gut immunity. Given its significant role in these diseases, CCR9 has emerged as a potential therapeutic target. Research efforts have increasingly focused on the development of CCR9-targeted therapies, including monoclonal antibodies and small molecules aimed at inhibiting its function. By producing and studying CCR9 recombinant proteins, researchers can gain valuable insights into its structure, signaling mechanisms, and interactions with ligands, paving the way for the development of innovative treatments. Understanding CCR9's role in immune cell trafficking and its involvement in disease pathology could lead to novel strategies for managing IBD and other conditions characterized by dysregulated immune responses. Overall, the exploration of CCR9 through recombinant protein studies holds promise for advancing our understanding of immune regulation and developing targeted therapies to improve patient outcomes.











