Analytical Data
-
Gene name
AP1S2
- Application
-
Alternative Names
AP1S2；AP-1 complex subunit sigma-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56377
-
Expression Region
1-157aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQFMLLFSRQGKLRLQKWYVPLSDKEKKKI TRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITL EIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV LKAIEQADLLQEEAETPRSVLEEIGLT
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AP1S2, also known as AP-1 complex subunit sigma-2, is a crucial component of the adaptor protein complex AP-1, which plays a significant role in intracellular trafficking and membrane biogenesis. Research into AP1S2 has gained prominence due to its involvement in various cellular processes, including endocytosis, exocytosis, and signaling pathways. Mutations and dysregulation of AP1S2 are linked to several diseases, including intellectual disabilities and other neurodevelopmental disorders. The importance of understanding AP1S2 is underscored by its potential as a therapeutic target and its role in cellular homeostasis. Studies have employed various techniques, including recombinant DNA technology, to produce and analyze AP1S2 protein, allowing researchers to explore its structure and function. The generation of recombinant AP1S2 has enabled detailed investigations into its interactions with other proteins and its role in the assembly and function of the AP-1 complex. As the field progresses, insights gained from AP1S2 research could contribute to the development of novel strategies for diagnosing and treating diseases linked to its dysfunction. Understanding the molecular mechanisms of AP1S2 will provide valuable knowledge regarding intracellular trafficking pathways, which are vital for maintaining cellular health and function.
