Analytical Data
-
Gene name
Acrp30
- Application
-
Alternative Names
Acrp30；ACDC；ACRP30；APM1；Adiponectin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15848
-
Expression Region
19-244aa
-
AA Sequence
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEK GDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVG LETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYM KDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGE GERNGLYADNDNDSTFTGFLLYHDTN
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Acrp30, also known as adiponectin, is a protein primarily produced by adipose tissue and plays a crucial role in regulating glucose levels as well as fatty acid breakdown. It exists in several forms, with the full-length protein and its globular domain being of particular interest in scientific research. The physiological significance of Acrp30 lies in its anti-inflammatory and insulin-sensitizing properties, making it a focal point in studies related to obesity, type 2 diabetes, and cardiovascular diseases. Research has demonstrated that low circulating levels of Acrp30 are associated with metabolic disorders, and increasing its levels may exert beneficial effects on metabolic health. Due to its involvement in these key metabolic pathways, recombinant Acrp30 proteins have garnered attention for their potential use in therapeutic interventions. Furthermore, the study of Acrp30’s mechanisms of action can unravel new insights into adipose tissue function, offering promising avenues for treating obesity-related conditions. Thus, the production and characterization of recombinant Acrp30 have significant implications in biomedical research, aiming to develop innovative strategies for enhancing metabolic health and preventing associated diseases.
