Analytical Data
-
Gene name
ACYP1
- Application
-
Alternative Names
ACYP1；ACYPE；Acylphosphatase-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07311
-
Expression Region
1- 99aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHT QAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHID KANFNNEKVILKLDYSDFQIVK
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACYP1, or Acylphosphatase 1, is an important enzyme implicated in various biological processes, including muscle function, metabolism, and signal transduction. Its primary role involves the hydrolysis of acyl phosphate bonds, thus influencing energy homeostasis in cells. Recent studies have indicated that ACYP1 may play a critical role in the regulation of cellular stress responses, including those induced by oxidative stress, as well as in certain pathological conditions such as cancer and heart disease. Given its significance, the recombinant expression of ACYP1 has garnered increasing attention in biochemical research, aiming to elucidate its structural and functional properties in detail. Producing ACYP1 as a recombinant protein allows researchers to investigate its enzymatic activity, interaction with other proteins, and its potential as a therapeutic target. This research is vital for understanding the mechanistic pathways involving ACYP1 and exploring its application in drug development and disease management. Through advanced techniques such as site-directed mutagenesis and structural analysis using X-ray crystallography or NMR spectroscopy, scientists are working to determine the precise mechanisms by which ACYP1 exerts its effects at the molecular level. Understanding these dynamics not only enhances the fundamental knowledge of enzymatic functions but also paves the way for innovative therapeutic strategies targeting ACYP1-related pathways.
