Analytical Data
-
Gene name
DCN1-like 蛋白 1/DCUN1D1
-
简介
DCN1-like protein 1 (DCUN1D1) is an important component of the E3 ubiquitin ligase complex and promotes neddylation of the cullin component within the E3 cullin-RING ubiquitin ligase complex. By binding to the cullin-RBX1 complex in the cytoplasm, DCUN1D1 promotes its nuclear translocation, enhances E2-NEDD8 thioester recruitment, and optimizes protein orientation for efficient NEDD8 transfer. DCN1-like protein 1/DCUN1D1 Protein, Human (His) is the recombinant human-derived DCN1-like protein 1/DCUN1D1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GG9
-
Expression Region
M1-V259
-
AA Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
-
Protein Length
Full Length
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCN1-like protein 1, also known as DCUN1D1, plays a crucial role in the regulation of protein degradation and cellular stress responses. It is part of the DCUN1D family, which is involved in the ubiquitin-proteasome system, a vital pathway for the degradation of misfolded and damaged proteins. Research has shown that DCUN1D1 is essential for the assembly of CUL4-based ubiquitin ligases, which are critical for targeting proteins for ubiquitination and subsequent degradation. The dysfunction of DCUN1D1 has been linked to various diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. However, the precise molecular mechanisms underlying its function remain poorly understood. Recent studies have focused on the expression and functional characterization of recombinant DCUN1D1 to elucidate its role in cellular processes. By generating a recombinant form of this protein, researchers aim to investigate its interactions with other proteins, its involvement in ubiquitination pathways, and its effects on cellular responses to stress. This research is vital for developing strategies to modulate DCUN1D1 activity, potentially leading to novel treatments for diseases where protein homeostasis is disrupted. The insights gained from studying DCUN1D1 could contribute significantly to our understanding of the ubiquitin-proteasome system and its implications in health and disease.
