Analytical Data
-
Gene name
MYBPC3
-
简介
MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (HEK293, His) is the recombinant human-derived MYBPC3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q14896-1
-
Expression Region
M1-A328
-
AA Sequence
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA
-
Protein Length
Partial
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYBPC3 (myosin-binding protein C, cardiac) is a critical sarcomeric protein predominantly found in cardiac muscle, playing a vital role in the structure and function of cardiac myocytes. Mutations in the MYBPC3 gene are known to cause familial hypertrophic cardiomyopathy (HCM), a common genetic cardiovascular disorder characterized by abnormal thickening of the heart muscle, which can lead to heart failure and sudden cardiac death. The study of MYBPC3 recombinant proteins has garnered significant interest in recent years as researchers aim to understand the molecular mechanisms underlying HCM. By expressing and purifying recombinant MYBPC3, scientists can investigate the impact of specific mutations on protein function, stability, and interaction with other sarcomeric proteins. This research is crucial not only for elucidating the pathophysiology of HCM but also for developing potential therapeutic strategies, including gene therapies and small molecules. Additionally, understanding the structural and functional properties of MYBPC3 through recombinant protein studies can provide insights into the broader context of cardiac muscle function and the development of heart disease. Overall, MYBPC3 recombinant protein research holds promise for advancing our comprehension of cardiac disorders and paving the way for innovative treatments.











