Cat: IPD-X34290

Recombinant Mouse EphA6 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphA6

  • 简介

    EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA6 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphA6 at 2 μg/mL(100 μL/well) can bind biotinylated recombinant mouse EphrinA3. The ED50 for this effect is 42.95 ng/mL. Measured by its binding ability in a functional ELISA.Immobilized recombinant mouse EphA6 at 2 μg/mL (100 μL/well) can bind biotinylated recombinant mouse EphrinA3 .The ED50 for this effect is 42.95 ng/mL.

  • Alternative Names

    Ephrin type-A receptor 6; EPH homology kinase 2; EHK-2; Epha6

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q62413

  • Expression Region

    W23-Q546

  • AA Sequence

    WTGDCSHVSNQVVLLDTTTVMGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYIESDESHGTKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSSTYVEATSVCHCEKGYFRAEKDPPSMACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTTQCEDCGGGLRFIPRHTGLINNSVVVLDFVSHVNYTFEIEAMNGVSELSISPKPFTAITVTTDHDAPSLIGMMRKDWASQNSLALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIVTGLKPATTYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQ

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphA6, a member of the Eph receptor tyrosine kinase family, plays a critical role in various biological processes, including neuronal development, tissue boundary formation, and cell migration. Its ligands, known as ephrins, are also vital in mediating cell-cell communication, which is essential for tissue organization and function. The exploration of EphA6 recombinant proteins has gained significance in recent years due to their potential implications in understanding neurological disorders and cancer progression. Studies have indicated that aberrant EphA6 signaling can contribute to the pathogenesis of diseases such as Alzheimer's, as well as various types of cancers where its expression levels are often altered. By producing recombinant EphA6 proteins, researchers aim to investigate its structural characteristics, signaling pathways, and interactions with ephrins and other cellular components. This knowledge could provide insights into its role in normal physiology and disease mechanisms. Furthermore, the availability of EphA6 recombinant proteins opens avenues for therapeutic interventions, including the development of targeted drugs that modulate EphA6 activity. The research on EphA6 is therefore pivotal in not only expanding our fundamental understanding of receptor tyrosine kinases but also in advancing potential clinical applications aimed at improving outcomes for patients affected by EphA6-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US