Analytical Data
-
Gene name
EGFR
-
简介
The EGFRvIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, His) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuEpidermal Growth Factor Receptor/EGFR vIII, His; Epidermal growth factor receptor; EGFR; Proto-oncogene c-ErbB-1; Receptor tyrosine-protein kinase erbB-1; EGFR
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_001333870
-
Expression Region
L25-S378
-
AA Sequence
LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS
-
Protein Length
Partial
-
Molecular Weight
61-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Epidermal Growth Factor Receptor (EGFR) is a pivotal protein in cellular signaling pathways related to cell proliferation, differentiation, and survival, making it a critical player in various cancers, particularly non-small cell lung cancer (NSCLC). The abnormal activation of EGFR due to mutations or overexpression can lead to uncontrolled cell growth and tumor development. This has spurred extensive research into EGFR-targeted therapies, such as monoclonal antibodies and tyrosine kinase inhibitors, improving treatment outcomes for many patients. Furthermore, the study of recombinant EGFR protein has gained prominence in both basic and clinical research, allowing for the exploration of its structure-function relationship, signaling mechanisms, and interaction with potential therapeutic agents. Recombinant EGFR proteins serve as valuable tools in drug development, enabling high-throughput screening of small molecules and the investigation of resistance mechanisms in therapy. Understanding the nuances of EGFR biology through the lens of recombinant proteins can enhance the design of novel therapeutics and combination strategies, ultimately contributing to more effective cancer treatments and improved patient survival rates.











