Analytical Data
-
Gene name
DUSP14
-
简介
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is ≤8.219 ng/mL, corresponding to a specific activity is ≥1.217×105 units/mg. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 5.031 ng/mL, corresponding to a specific activity is 1.988×105 units/mg.
-
Alternative Names
Dual specificity protein phosphatase 14; MKP-L; MKP-6; DUSP14
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O95147
-
Expression Region
M1-H191
-
AA Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH
-
Protein Length
Partial
-
Molecular Weight
21-23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUSP14 (Dual Specificity Phosphatase 14) is a crucial regulator in cellular signaling pathways, primarily involved in dephosphorylating both tyrosine and serine/threonine residues in various target proteins. This dual specificity contributes to its role in modulating key signaling pathways, such as those related to inflammation, cell proliferation, and differentiation. Research into DUSP14 has gained momentum due to its potential implications in various diseases, including cancer and autoimmune disorders. The overexpression or dysregulation of DUSP14 has been linked to tumor progression and resistance to therapies, making it a significant focus for therapeutic intervention. Recently, the production of recombinant DUSP14 protein has enabled detailed structural and functional studies, allowing scientists to elucidate its mechanisms of action and interactions with other signaling molecules. Understanding these interactions provides insights into how DUSP14 maintains cellular homeostasis and its potential as a drug target. Furthermore, studies utilizing DUSP14 recombinant proteins may facilitate the development of novel biomarkers for disease diagnosis and prognosis, highlighting the importance of this phosphatase in both basic and applied biomedical research. As the understanding of DUSP14 continues to evolve, it holds promise for the development of innovative therapeutic strategies aimed at diseases driven by aberrant signaling pathways.
