Analytical Data
-
Gene name
Tetranectin/CLEC3B
-
简介
Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology. Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes. Tetranectin/CLEC3B Protein, Human (181a.a, HEK293, His) is the recombinant human-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human HGF (HY-P70627) at 5 μg/mL (100 μL/well) can bind Biotinylated Human CLEC3B. The ED50 for this effect is 4.903 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Human HGF (HY-P70627) at 5 μg/mL (100 μL/well) can bind Biotinylated Human CLEC3B. The ED50 for this effect is 4.903 μg/mL.
-
Alternative Names
rHuTetranectin/ CLEC3B, His; Tetranectin; TN; C-Type Lectin Domain Family 3 Member B; Plasminogen Kringle 4-Binding Protein; CLEC3B; TNA
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
AAH11024.1
-
Expression Region
E22-V202
-
AA Sequence
EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
-
Protein Length
Partial
-
Molecular Weight
20-24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tetranectin, also known as CLEC3B, is a secreted glycoprotein primarily produced in the liver and has garnered significant interest due to its multifaceted roles in various biological processes. It belongs to the C-type lectin family, characterized by its ability to bind to glycoproteins through calcium-dependent mechanisms. Research has shown that tetranectin plays a critical role in tissue remodeling, cell adhesion, and inflammation, making it a potential biomarker for several diseases, including cancer and liver disorders. Additionally, its involvement in the regulation of extracellular matrix components suggests a significant role in wound healing and fibrotic processes. The study of recombinant tetranectin/CLEC3B proteins has facilitated the exploration of their functional capabilities, providing insights into their interactions with cells and other biomolecules. Understanding these interactions is essential for elucidating the protein's physiological roles and its potential implications in therapeutic applications, including targeted drug delivery and regenerative medicine. Current studies are focusing on the detailed characterization of its binding properties and the signaling pathways it influences, aiming to leverage its functions for innovative clinical strategies.
