Analytical Data
-
Gene name
TWSG1
-
简介
The TWSG1 protein may contribute to the formation of the dorsal-ventral axis by counteracting BMP signaling and forming a ternary complex with CHRD and BMP to prevent BMP from binding to the receptor. Notably, TWSG1 exhibits anti-BMP and pro-BMP activities. TWSG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TWSG1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Twisted Gastrulation Protein Homolog 1; TWSG1; TSG
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9EP52
-
Expression Region
C25-F222
-
AA Sequence
CNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
27-33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TXNL4A (Thioredoxin-like 4A) is a member of the thioredoxin superfamily, known for its role in redox regulation and its involvement in various cellular processes, including cell proliferation, apoptosis, and stress response. Recent studies have highlighted TXNL4A as a pivotal player in the regulation of protein stability and function, particularly under oxidative stress conditions. Its distinct thioredoxin-like domain suggests potential functions in maintaining cellular redox homeostasis and in the modulation of the immune response. Researchers have begun to investigate the implications of TXNL4A in pathological conditions like cancer, where its expression levels can influence tumor progression and treatment outcomes. The recombinant expression of TXNL4A in various expression systems allows for the detailed study of its structural and functional characteristics, paving the way for potential therapeutic applications. Understanding the mechanisms behind TXNL4A's function at the molecular level could unveil new strategies for targeting oxidative stress-related diseases, thereby emphasizing the importance of this protein in both basic and translational research. Overall, the study of TXNL4A and its recombinant protein provides significant insight into redox biology, with potential implications for improving therapeutic interventions in diseases associated with oxidative stress.
