Cat: IPD-X30383

Recombinant Human ADAM17/TACE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAM17/TACE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD156b; TACE; CSVP; Tumor Necrosis Factor,Alpha,Converting Enzyme; Disintegrin and metalloproteinase domain-containing protein 17; Snake venom-like protease

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P78536

  • Expression Region

    226~473aa

  • AA Sequence

    KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQI EQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVC LAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTST KNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVS GDHENNKMFSNCSKQSIYKTIESKAQECFQER

  • Molecular Weight

    29.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAM17, also known as TACE (Tumor Necrosis Factor-α Convertase), is a member of the ADAM (A Disintegrin and Metalloproteinase) family of zinc-dependent metalloproteinases. It plays a pivotal role in ectodomain shedding of various membrane proteins, including cytokines, growth factors, and receptors. This process is crucial for regulating cell signaling and communication, contributing to processes such as inflammation, immune response, and tissue remodeling. Dysregulation of ADAM17 activity is implicated in several pathologies, including cancer, autoimmune diseases, and cardiovascular disorders, making it an attractive target for therapeutic intervention. The recombinant protein of ADAM17/TACE can provide crucial insights into its structural and functional characteristics. By studying this protein, researchers aim to elucidate its specific mechanisms of action, regulatory pathways, and interactions with substrates. Furthermore, developing inhibitors or modulators of ADAM17 could potentially offer new therapeutic avenues for treating diseases driven by altered shedding processes. As such, the investigation of ADAM17/TACE recombinantly expressed protein is fundamental in advancing our understanding of its biological roles and translating this knowledge into clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US