Analytical Data
-
Gene name
DUSP3
-
简介
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is ≤8.219 ng/mL, corresponding to a specific activity is ≥1.217×105 units/mg. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 5.031 ng/mL, corresponding to a specific activity is 1.988×105 units/mg.
-
Alternative Names
Dual specificity protein phosphatase 14; MKP-L; MKP-6; DUSP14
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O95147
-
Expression Region
M1-H191
-
AA Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH
-
Protein Length
Partial
-
Molecular Weight
21-23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUSP3, also known as Dual Specificity Phosphatase 3, is part of the dual specificity phosphatase family, which plays a crucial role in the regulation of various signaling pathways by dephosphorylating both tyrosine and serine/threonine residues. The importance of DUSP3 in cellular processes such as growth, differentiation, and response to stress has drawn significant research attention. Dysregulation of DUSP3 has been implicated in several diseases, including cancer, suggesting that it might serve as a potential therapeutic target. Moreover, understanding the specific mechanisms through which DUSP3 operates can elucidate its role in the mitogen-activated protein kinase (MAPK) pathway, influencing cellular responses to extracellular signals. This makes DUSP3 not only a key player in fundamental biological processes but also a promising candidate for the development of innovative treatment strategies. Investigating the structural and functional properties of recombinant DUSP3 proteins can provide insights into their enzymatic activity and interaction with substrates, thus paving the way for further understanding of their biological significance and potential medical applications. Given these considerations, the research on DUSP3 recombinant proteins has significant implications for both basic and translational research in biomedical sciences.











