Analytical Data
-
Gene name
CSRP1
-
简介
The CSRP1 protein is a protein that may be involved in neuronal development. It is known to interact with three other proteins: ASCC1, ASCC2 and TRIP4. CSRP1 Protein, Human (His) is the recombinant human-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.
- Application
-
Alternative Names
Cysteine and glycine-rich protein 1; CRP1; HEL-141; CSRP; CYRP
-
Species
Human
-
Source
E. coli
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P21291
-
Expression Region
M1-E193
-
AA Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
-
Protein Length
Full Length
-
Molecular Weight
22 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSRP1 (Cysteine and Serine-Rich Protein 1) is a member of the CSRP family of proteins, characterized by their unique zinc finger domains and significant roles in gene regulation, cellular differentiation, and tissue development. Research into CSRP1 has gained momentum as it is implicated in various physiological processes and pathologies, including cardiac development, smooth muscle cell differentiation, and cancer progression. Notably, CSRP1 influences the actin cytoskeleton and is vital for muscle cell morphology and function. Due to its involvement in critical signaling pathways, abnormalities in CSRP1 expression or function have been associated with diseases such as cardiovascular disorders and certain malignancies. The production of recombinant CSRP1 protein has become essential for elucidating its biological roles and mechanisms of action in cellular contexts. Through structural and functional studies on CSRP1, researchers aim to dissect its contributions to gene expression regulation and its interactions with other signaling molecules. Understanding the mechanism of CSRP1 not only provides insights into fundamental biological processes but also opens avenues for developing targeted therapies for diseases linked to its dysregulation. Therefore, the study of recombinant CSRP1 serves as a crucial step towards unveiling the complex network of molecular interactions and pathways in which this protein participates, ultimately enhancing our understanding of its role in health and disease.











