Analytical Data
-
Gene name
S100A3
-
简介
S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.
- Application
-
Alternative Names
Protein S100-A3; Protein S-100E; S100 calcium-binding protein A3
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His Tag
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P62818
-
Expression Region
1-101aa
-
AA Sequence
MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECD YNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
-
Protein Length
Full Length
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
S100A3 is a member of the S100 family of proteins, known for their role in various intracellular processes, including calcium binding, signal transduction, and regulation of cell proliferation and differentiation. Research has shown that S100A3 is involved in multiple pathological conditions, particularly in cancer, where its expression often correlates with tumor progression and metastasis. Recent studies have highlighted its potential as a biomarker for specific cancers. Moreover, S100A3 has been implicated in inflammatory responses, suggesting its role in immune system modulation. Due to its significant functions, there is increasing interest in the development of recombinant S100A3 protein for both therapeutic and diagnostic applications. Understanding its structure and interactions can pave the way for novel strategies in cancer treatment and individualized medicine. Therefore, producing recombinant S100A3 protein can help elucidate its biological functions and provide insights into its potential as a target for drug development and as a tool for biomarker discovery. This research is critical for advancing the knowledge of S100 protein implications in health and disease, ultimately offering prospects for innovative therapeutic approaches.











