Cat: IPD-X25794

Recombinant Human FRZB Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FRZB

  • 简介

    FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Secreted frizzled-related protein 3; sFRP-3; Frezzled; FrzB-1; FRZB; SFRP3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92765

  • Expression Region

    A32-N325

  • AA Sequence

    AAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FRZB, or Frizzled-related protein, is a secreted antagonist of the Wnt signaling pathway, which plays critical roles in cell proliferation, differentiation, and tissue homeostasis. Its discovery provided insights into the regulatory mechanisms governing embryonic development and cellular communication. Research has highlighted FRZB's importance in various biological processes, including bone density regulation and the development of certain cancers. Notably, alterations in FRZB expression have been associated with conditions such as osteoarthritis and multiple types of tumors. Given its involvement in key signaling pathways, FRZB has garnered attention as a potential therapeutic target. Investigations into the structure and function of FRZB have revealed its ability to bind to Wnt ligands, thereby inhibiting their interaction with Frizzled receptors. This has prompted studies aimed at understanding the molecular mechanisms of FRZB, its role in pathophysiological conditions, and the potential for utilizing FRZB-based interventions in regenerative medicine and cancer therapy. As research continues to uncover the multifaceted roles of FRZB, it holds promise for the development of novel strategies to modulate Wnt signaling in various diseases, making it a focal point of interest in contemporary biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US