Cat: IPD-X30095

Recombinant Human Kallikrein-2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-2

  • 简介

    The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability. Kallikrein-2 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuKallikrein 2/KLK2, His; Kallikrein-2; Glandular Kallikrein-1; hGK-1; Tissue Kallikrein-2; KLK2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20151-1

  • Expression Region

    P19-P261

  • AA Sequence

    PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    (10-12)&(16-19)&(28-33) KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-2 (KLK2) is a serine protease belonging to the kallikrein family, which has garnered significant attention due to its potential roles in various physiological and pathological processes, particularly in cancer biology. Elevated levels of KLK2 have been associated with prostate cancer progression, making it a candidate biomarker for diagnosis and prognosis. Furthermore, KLK2 is involved in the regulation of extracellular matrix components and inflammation, which are critical in tumor microenvironments. The study of KLK2 has been propelled by advancements in recombinant DNA technology, enabling the production of KLK2 recombinant proteins for in-depth analysis of its functions, regulatory mechanisms, and interactions with other proteins. Investigating KLK2 may provide insights into its enzymatic activity, substrate specificity, and potential therapeutic applications, including the development of KLK2 inhibitors that could modulate its activity in cancer treatment. As research continues to unravel the complex roles of KLK2 in disease, the recombinant protein serves as a valuable tool for elucidating its biological relevance and therapeutic potentials.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US