Analytical Data
-
Gene name
ECM1
-
简介
The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Extracellular matrix protein 1; Secretory component p85; Ecm1
-
Species
Rat
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q62894
-
Expression Region
A20-E562
-
AA Sequence
ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
75-80 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECM1 (Extracellular Matrix Protein 1) is a protein that plays a crucial role in the structure and function of the extracellular matrix (ECM), which is essential for tissue development, integrity, and repair. Research on ECM1 has gained attention due to its involvement in various biological processes and potential implications in diseases such as cancer, fibrosis, and vascular disorders. The protein is known to interact with different cellular components, including glycoproteins and growth factors, influencing cell behavior and signaling pathways. Studies have shown that ECM1 can regulate cellular adhesion, migration, and differentiation, making it a key player in tissue homeostasis and regeneration. Furthermore, alterations in ECM1 expression have been associated with pathological conditions, thus highlighting its significance as a potential biomarker or therapeutic target. Given the complexity of ECM interactions and their impact on cellular functions, the recombinant expression and characterization of ECM1 is necessary to better understand its precise role in health and disease. Advanced techniques, including genetic engineering and recombinant DNA technology, are being employed to produce ECM1 in various systems, allowing for in-depth functional studies and the exploration of its therapeutic potential.











