Analytical Data
-
Gene name
FKBP14
-
简介
The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Peptidyl-prolyl cis-trans isomerase FKBP14; 22 kDa FKBP; FKBP-22; FKBP-14
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9NWM8
-
Expression Region
A20-K207
-
AA Sequence
ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
25&27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKBP14, a member of the FK506-binding protein family, plays a crucial role in the regulation of protein folding and is implicated in various physiological processes, including stress responses and cell signaling. Research on FKBP14 has gained significant attention due to its involvement in human diseases, particularly in the context of myopathies and collagen-related disorders. Mutations in the FKBP14 gene have been associated with conditions like myopathy with early respiratory failure and Ehlers-Danlos syndrome, highlighting its importance in maintaining cellular homeostasis. The study of FKBP14 recombinant protein is vital for understanding its structure-function relationship and the molecular mechanisms underlying its role in disease. Producing FKBP14 as a recombinant protein enables researchers to investigate its biochemical properties, interactions with other proteins, and potential as a therapeutic target. Furthermore, this research can facilitate the development of novel therapeutic approaches for disorders associated with FKBP14 dysfunction, contributing to advancements in precision medicine and targeted therapies. Overall, investigating FKBP14 recombinant protein enhances our understanding of its biological significance and opens new avenues for therapeutic innovations.
