Recombinant Rat Decorin/PGS2 Protein (HEK293)，His

Decorin/PGS2

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis. Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis.

Decorin; Bone proteoglycan II; PG-S2; PG40; DCN; SLRR1B

Rat

HEK293

C-6*His

Greater than 95% as determined by SDS-PAGE.

Q01129

G17-K354

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK

Full Length of Mature Protein

43-48 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.