Analytical Data
-
Gene name
cIAP1/BIRC2
- Application
-
Alternative Names
Baculoviral IAP repeat-containing protein 2; IAP homolog B; hIAP-2; BIRC2; API1; MIHB; RNF48
-
Species
Human
-
Source
E. coli
-
Tag
C-Avi
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_001157.1
-
Expression Region
NP_001157.1 (N-G&P, E144-L356)
-
AA Sequence
EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL
-
Protein Length
Partial
-
Molecular Weight
26.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
cIAP1 (Cellular Inhibitor of Apoptosis Protein 1), also known as BIRC2 (Baculoviral IAP Repeat Containing 2), is a critical regulator of apoptosis and cell survival, playing a key role in cancer biology. It belongs to the inhibitor of apoptosis protein (IAP) family, which is characterized by the presence of baculoviral IAP repeats that facilitate its anti-apoptotic functions. cIAP1 is known to promote cell proliferation and inhibit programmed cell death, making it a significant factor in tumorigenesis and cancer progression. Research has shown that cIAP1/BIRC2 is often overexpressed in various malignancies and contributes to chemoresistance, presenting it as a potential therapeutic target. The study of its recombinant protein allows for a deeper understanding of its structural and functional properties, enabling the exploration of its interactions with other cellular molecules and signaling pathways. This protein has garnered attention in drug development, particularly in the design of inhibitors that can selectively disrupt its anti-apoptotic functions, thus restoring the apoptotic response in cancer cells. Additionally, investigations into cIAP1's role in immune regulation and inflammation further underscore its importance in both tumor biology and therapeutic interventions. Overall, cIAP1/BIRC2 represents a fascinating and vital component in the complexity of cancer mechanisms, making it a subject of intense scientific inquiry aimed at developing novel treatment strategies.
