Cat: IPD-X29892

Recombinant Human cIAP1/BIRC2 Protein,Avi

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    cIAP1/BIRC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Baculoviral IAP repeat-containing protein 2; IAP homolog B; hIAP-2; BIRC2; API1; MIHB; RNF48

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-Avi

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    NP_001157.1

  • Expression Region

    NP_001157.1 (N-G&P, E144-L356)

  • AA Sequence

    EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL

  • Protein Length

    Partial

  • Molecular Weight

    26.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

cIAP1 (Cellular Inhibitor of Apoptosis Protein 1), also known as BIRC2 (Baculoviral IAP Repeat Containing 2), is a critical regulator of apoptosis and cell survival, playing a key role in cancer biology. It belongs to the inhibitor of apoptosis protein (IAP) family, which is characterized by the presence of baculoviral IAP repeats that facilitate its anti-apoptotic functions. cIAP1 is known to promote cell proliferation and inhibit programmed cell death, making it a significant factor in tumorigenesis and cancer progression. Research has shown that cIAP1/BIRC2 is often overexpressed in various malignancies and contributes to chemoresistance, presenting it as a potential therapeutic target. The study of its recombinant protein allows for a deeper understanding of its structural and functional properties, enabling the exploration of its interactions with other cellular molecules and signaling pathways. This protein has garnered attention in drug development, particularly in the design of inhibitors that can selectively disrupt its anti-apoptotic functions, thus restoring the apoptotic response in cancer cells. Additionally, investigations into cIAP1's role in immune regulation and inflammation further underscore its importance in both tumor biology and therapeutic interventions. Overall, cIAP1/BIRC2 represents a fascinating and vital component in the complexity of cancer mechanisms, making it a subject of intense scientific inquiry aimed at developing novel treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US