Analytical Data
-
Gene name
AKT1
-
简介
The AKT1 protein is part of the AKT kinase family and is critical for metabolism, proliferation, survival, growth, and angiogenesis. It phosphorylates more than 100 substrates, coordinates insulin-induced SLC2A4/GLUT4 translocation, affects glucose uptake, and controls glycogen storage through inhibition of GSK3A/B. AKT1 Protein, Human (S473D, sf9, His, GST) is the recombinant human-derived AKT1 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.
- Application
-
Alternative Names
RAC-alpha serine/threonine-protein kinase; PKB; RAC-PK-alpha; AKT1; RAC
-
Species
Human
-
Source
Baculovirus
-
Tag
N-His;N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31749
-
Expression Region
S473D, M118-A480
-
AA Sequence
MDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFDYSASGTA
-
Protein Length
Partial
-
Molecular Weight
69.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AKT1, also known as Protein Kinase B, is a critical serine/threonine kinase that plays a pivotal role in various cellular processes, including glucose metabolism, apoptosis, cell proliferation, and growth factor signaling. Its dysregulation has been implicated in numerous diseases, particularly cancer, as AKT1 is often found to be overactive or mutated in various tumor types, leading to enhanced survival and growth of cancer cells. Given its central role in the phosphoinositide 3-kinase (PI3K) signaling pathway, AKT1 has emerged as a promising target for therapeutic interventions. Research on recombinant AKT1 protein is vital, as it allows for the detailed study of its biochemical properties, regulatory mechanisms, and interactions with other signaling molecules. By producing AKT1 through recombinant DNA technology, scientists can investigate its functional role in vitro and in vivo, paving the way for the development of specific inhibitors and biomarkers for cancer diagnosis and treatment. Furthermore, understanding the dynamics of AKT1 phosphorylation and its downstream targets can elucidate the complex signaling networks involved in cellular responses to stress and growth signals. The study of recombinant AKT1 not only enhances our understanding of its physiological relevance but also contributes to the identification of potential drug targets, offering hope for novel therapeutic strategies in cancer treatment and other metabolic disorders.











