Analytical Data
-
Gene name
DENR
-
简介
DENR proteins play a key role in the translation process, participating in mRNA scanning and start codon recognition. It crucially promotes the recruitment of aminoacylated initiator tRNA to the 40S ribosomal P site during translation initiation. DENR Protein, Human (His-SUMO) is the recombinant human-derived DENR protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Application
-
Alternative Names
denr; DENR_HUMAN; Density regulated protein; Density-regulated protein; DRP; DRP1; DRP1 protein; Protein DRP1; SMAP-3; SMAP3; Smooth muscle cell associated protein 3; Smooth muscle cell-associated protein 3
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43583
-
Expression Region
A2-K198
-
AA Sequence
AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
46 kDa.The reducing (R) protein migrat es as 46 kDa in SDS-PAGE may be due to relative charge.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DSP (Dipeptidyl Peptidase) is a vital protease involved in various biological processes, including protein maturation and metabolism. The study of DSP recombinant proteins has gained significant attention due to their potential applications in medicine and biotechnology. Researchers focus on the expression and purification of DSP proteins to better understand their functional roles and mechanisms in vivo. By utilizing recombinant DNA technology, scientists can produce large quantities of DSP proteins, enabling detailed biochemical and structural analyses. These investigations are crucial for uncovering the enzymatic activity of DSPs and their impact on physiological pathways, such as immune response and tissue remodeling. Additionally, recombinant DSP proteins have promising therapeutic applications, including the development of enzyme inhibitors for diseases like diabetes and cancer. As a result, the exploration of DSP recombinant proteins not only enhances our understanding of fundamental biological processes but also paves the way for innovative treatments targeting various health conditions. Through ongoing research, the full potential of DSP proteins in therapeutic interventions continues to unfold, making it a significant area of interest in the fields of molecular biology and pharmacology.
