Analytical Data
-
Gene name
JAK1
-
简介
JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag.
- Application
-
Alternative Names
JAK1; JAK-1; JAK1A; JAK1B; Jak1
-
Species
Human
-
Source
Baculovirus
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P23458
-
Expression Region
A561-N852
-
AA Sequence
AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN
-
Protein Length
Partial
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JAK1, or Janus kinase 1, is a critical signaling protein that plays a pivotal role in various biological processes, including immunity, inflammation, and hematopoiesis. As a part of the Janus kinase family, JAK1 is involved in the signaling pathways of multiple cytokine receptors, facilitating the transduction of signals from extracellular ligands to intracellular responses. Dysregulation of JAK1 is associated with several diseases, including autoimmune disorders, cancers, and cytokine storms, making it a significant target for therapeutic intervention. The study of recombinant JAK1 proteins has gained momentum, allowing researchers to investigate its structure, function, and interaction with various signaling molecules in detail. Recombinant JAK1 proteins are produced through genetic engineering techniques, providing a purified and active form of the protein for various applications, such as drug screening, structural studies, and the development of JAK inhibitors. These inhibitors have shown promise in treating conditions like rheumatoid arthritis and psoriasis by modulating immune responses. Understanding the biochemical properties and regulatory mechanisms of JAK1 through recombinant protein studies is crucial for developing targeted therapies and advancing our knowledge of JAK-STAT signaling pathways in health and disease.











