Analytical Data
-
Gene name
SYNGAP1
-
简介
SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
DKFZp761G1421 ; KIAA1938; MRD5; Neuronal RasGAP; OTTHUMP00000064825; p135 SynGAP; Ras GTPase activating protein SynGAP; Synaptic Ras-GAP 1; SYNGAP 1; SYNGAP1
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PV0
-
Expression Region
M1161-H1343
-
AA Sequence
MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
-
Protein Length
Partial
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYNGAP1 is a gene located on chromosome 6 that encodes a protein involved in synaptic signaling and plasticity in the brain. Mutations in SYNGAP1 have been linked to a range of neurodevelopmental disorders, including intellectual disability and epilepsy. Research has shown that the SYNGAP1 protein plays a critical role in regulating synaptic strength and contributes to cognitive functions. As the understanding of SYNGAP1's role in neural circuitry deepens, there is a growing interest in developing therapeutic interventions that target SYNGAP1-related pathways. The production and study of recombinant SYNGAP1 protein are crucial for elucidating its molecular mechanisms and interactions within neuronal systems. By generating and characterizing recombinant SYNGAP1, scientists aim to investigate its structural properties, binding interactions, and functional impacts on neurodevelopment and synaptic behavior. This research not only enhances our understanding of the pathophysiology associated with SYNGAP1 mutations but also paves the way for potential therapeutic strategies aimed at ameliorating the cognitive and behavioral deficits observed in affected individuals.
