Cat: IPD-X33063

Recombinant Rat ROR1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ROR1

  • 简介

    ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg. Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.

  • Alternative Names

    ROR1; NTRKR1

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    D3ZZ97

  • Expression Region

    Q30-E403

  • AA Sequence

    QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

  • Protein Length

    Partial

  • Molecular Weight

    60-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ROR1 (Receptor tyrosine kinase-like orphan receptor 1) is a protein that plays a critical role in various cellular processes, including embryonic development and stem cell maintenance. Its expression is largely restricted to embryonic tissues and certain types of cancer cells, making it an attractive target for cancer immunotherapy. Research has shown that ROR1 is overexpressed in several malignancies, including chronic lymphocytic leukemia (CLL), breast cancer, and lung cancer, while being minimally present in normal adult tissues. This unique expression pattern has spurred interest in developing ROR1-targeted therapies, particularly recombinant proteins such as monoclonal antibodies and chimeric antigen receptors (CARs). These developments aim to harness the immune system to specifically recognize and eliminate ROR1-positive cancer cells, potentially reducing off-target effects and improving treatment efficacy. Additionally, ROR1's involvement in signaling pathways that promote tumorigenesis underscores its relevance in cancer biology. Current studies are focusing on understanding the molecular mechanisms governing ROR1's function and its potential as a biomarker for prognosis and treatment response. Overall, the exploration of ROR1 and its recombinant forms holds promise for advancing precision medicine strategies in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US