Analytical Data
-
Gene name
YAP1
-
简介
YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.
- Application
-
Alternative Names
Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog; YAP65; YAP1
-
Species
Human
-
Source
E. coli
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46937
-
Expression Region
M1-L504
-
AA Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
-
Protein Length
Full Length
-
Molecular Weight
72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YAP1 (Yes-associated protein 1) is a key downstream effector of the Hippo signaling pathway, which plays a crucial role in regulating cell growth, proliferation, and organ size. Dysregulation of this pathway and overexpression of YAP1 have been implicated in various cancers, including liver, breast, and stomach cancers, making it a significant target for cancer research. Studies have shown that YAP1 promotes cell survival and proliferation by regulating gene expression and interacting with various transcription factors. As a result, the recombinant expression of YAP1 has gained attention for its potential in understanding the molecular mechanisms underlying tumorigenesis and for developing targeted therapies. Researchers aim to produce recombinant YAP1 proteins for structural and functional studies, to elucidate its role in oncogenesis, and to identify novel inhibitors that could mitigate its effects in cancerous cells. The study of YAP1 not only provides insights into cancer biology but also opens avenues for therapeutic interventions aimed at restoring normal Hippo signaling, ultimately contributing to the development of effective cancer treatment strategies.
