Analytical Data
-
Gene name
EphB1
-
简介
The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Application
-
Alternative Names
Ephrin type-B receptor 1; ELK; EK6; NET; EPHB1; EPHT2; HEK6
-
Species
Human
-
Source
Baculovirus
-
Tag
N-His;N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAI11745.1
-
Expression Region
R565-A984
-
AA Sequence
RKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA
-
Protein Length
Partial
-
Molecular Weight
66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EphB1 is a member of the Eph receptor family, which encompasses a subclass of receptor tyrosine kinases known for their roles in mediating cell-cell interactions during developmental processes and tissue homeostasis. This receptor is particularly involved in pathways related to neuronal development, angiogenesis, and immune responses. Its interacting ephrin ligands, particularly ephrin-Bs, facilitate bidirectional signaling essential for various physiological functions. Aberrant EphB1 signaling has been implicated in multiple diseases, including cancer, where it may contribute to processes such as tumor progression and metastasis. Thus, understanding the structure and function of EphB1 has significant implications for therapeutic strategies. Research involving EphB1 recombinant protein has gained traction as it allows for the elucidation of its biological activities and molecular mechanisms. The production of EphB1 in a recombinant form enables detailed studies of its ligand interactions, signaling pathways, and potential as a target for drug development. Furthermore, the characterization of EphB1 through recombinant protein studies can shed light on its role in pathological conditions, opening avenues for innovative treatments based on modulation of EphB1 signaling. Given the complexity of its functions and the critical nature of its signaling in developmental and pathological contexts, continuous research on EphB1 remains vital for advancing our understanding of its contributions to health and disease.
