Analytical Data
-
Gene name
MOB1A
-
简介
In the Hippo signaling pathway, MOB1A acts as an important activator to control organ size and suppress tumors by regulating proliferation and apoptosis. MOB1A participates in the kinase cascade together with STK3/MST2 and STK4/MST1 to phosphorylate and activate LATS1/2, thereby affecting YAP1 oncoprotein and WWTR1/TAZ. MOB1A Protein, Human (His) is the recombinant human-derived MOB1A protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
MOB Kinase Activator 1A; Mob1 Alpha; Mob1A; Mob1 Homolog 1B; Mps One Binder Kinase Activator-like 1B; MOB1A; C2orf6; MOB4B; MOBK1B; MOBKL1B
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H8S9-1
-
Expression Region
S2-R216
-
AA Sequence
SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
28.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOB1A, a member of the MOb family of proteins, plays a critical role in various cellular processes, particularly in the regulation of the Hippo signaling pathway, which is essential for controlling cell growth, proliferation, and apoptosis. The Hippo pathway, while initially identified for its role in organ size regulation, has broader implications in cancer biology and tissue regeneration. Abnormalities in this pathway, often due to mutations in its components, can lead to uncontrolled cell growth and tumorigenesis. MOB1A, functioning as a co-factor for serine/threonine kinases, directly interacts with key signaling proteins to modulate their activity and ensure cellular homeostasis. Recent studies have highlighted the importance of MOB1A in promoting the phosphorylation of downstream targets, influencing cell fate decisions. As a result, understanding the structure, function, and regulatory mechanisms of MOB1A has become a focal point of research, with potential implications for targeted cancer therapies and regenerative medicine. Through the recombinant expression of MOB1A, scientists aim to elucidate its precise molecular interactions and downstream effects, paving the way for novel interventions in diseases linked to Hippo pathway dysregulation.











