Cat: IPD-X25072

Recombinant Human HSP40/DNAJB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HSP40/DNAJB1

  • 简介

    HSP40/DNAJB1 protein, a key player in cellular processes, interacts with HSP70 to enhance ATPase activity and stimulate HSC70-HIP association. It negatively regulates HSF1 transcriptional activity in heat shock response recovery, and interacts with DNAJC3 and HSF1, inhibiting their transcriptional activity. These multifaceted interactions showcase HSP40/DNAJB1's intricate regulatory functions in stress responses and protein folding. HSP40/DNAJB1 Protein, Human (His) is the recombinant human-derived HSP40/DNAJB1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25685-1

  • Expression Region

    G2-I340

  • AA Sequence

    GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HSP40, also known as DNAJB1, is a member of the heat shock protein (HSP) family and plays a crucial role in protein folding and cellular stress response. It acts as a molecular chaperone, facilitating the proper folding of nascent polypeptides and the refolding of misfolded proteins under stress conditions. The importance of HSP40/DNAJB1 has gained significant attention in the context of various diseases, including neurodegenerative disorders, cancer, and metabolic diseases, where protein aggregation and misfolding are prevalent. Recent studies have highlighted its interaction with HSP70, forming a chaperone complex that enhances protein homeostasis and cellular resilience. Additionally, HSP40/DNAJB1 has been implicated in the modulation of signaling pathways associated with cell survival and apoptosis, further underscoring its potential as a therapeutic target. Research into the recombinant expression of HSP40/DNAJB1 enables a deeper understanding of its functional mechanisms and offers insights into potential interventions for diseases characterized by protein misfolding. As scientists explore its structure-function relationships and regulatory mechanisms, the findings could pave the way for novel strategies aimed at enhancing cellular stress resistance and improving health outcomes in various pathological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US