Analytical Data
-
Gene name
CLIC5
-
简介
The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuChloride intracellular channel protein 5/CLIC5, His; Chloride Intracellular Channel Protein 5; CLIC5
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZA1-2
-
Expression Region
M1-S251
-
AA Sequence
MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
-
Protein Length
Full Length of Isoform-2
-
Molecular Weight
37.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC5 (Chloride Intracellular Channels 5) is a member of the CLIC protein family, which consists of chloride ion channels involved in various cellular processes. The research background surrounding CLIC5 focuses on its role in ion transport, cellular signaling, and involvement in diseases such as cancer and cardiovascular disorders. Unlike other ion channels, CLIC proteins exist in both soluble and membrane-associated forms, which suggests their versatile roles in cellular physiology. Recent studies have indicated that CLIC5 is implicated in modulating cell migration, proliferation, and apoptosis, emphasizing its potential as a therapeutic target. Furthermore, CLIC5 has been shown to interact with various signaling pathways, including those linked to inflammatory responses and cytoskeletal dynamics. Understanding the structure and function of CLIC5, particularly through recombinant protein studies, can provide insights into its mechanisms of action and the consequences of its dysregulation in pathological conditions. As researchers continue to explore CLIC5's properties and interactions, the potential for developing CLIC5-modulating drugs or interventions becomes increasingly compelling, highlighting its relevance in both basic research and clinical applications.
