Cat: IPD-X29425

Recombinant Human SMN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SMN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Survival Motor Neuron 1,SMN1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16637-1

  • Expression Region

    A2-N294

  • AA Sequence

    AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    36-40 kDa & 69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of SMN1 (Survival Motor Neuron 1) recombinant protein is primarily motivated by its crucial role in spinal muscular atrophy (SMA), a genetic disorder characterized by the degeneration of motor neurons in the spinal cord, leading to progressive muscle weakness and atrophy. SMN1 is essential for the survival and maintenance of motor neurons, and its loss or mutation results in insufficient levels of SMN protein, which is vital for several cellular processes, including RNA metabolism and transport. Understanding the structure and function of recombinant SMN1 protein is critical for elucidating the molecular mechanisms underlying SMA and developing effective therapeutic strategies. Recent advancements in recombinant DNA technology have facilitated the production of SMN1 protein in various biological systems, enabling researchers to study its biophysical properties, interaction with other cellular proteins, and the effects of SMN deficiency at a molecular level. This research is essential not only for accelerating the discovery of new SMA treatments but also for providing insights into related neuromuscular disorders. By generating and characterizing SMN1 recombinant protein, researchers aim to explore potential gene therapy approaches, small molecules, or other biological agents that can restore SMN function and improve motor neuron health. As such, the investigation of SMN1 recombinant protein stands at the forefront of neurogenetics and therapeutic development, with the potential to transform the lives of individuals affected by SMA.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US