Analytical Data
-
Gene name
ADAMTS14
- Application
-
Alternative Names
A disintegrin and metalloproteinase with thrombospondin motifs 14; ADAM-TS 14; ADAM-TS14; ADAMTS-14
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXS8
-
Expression Region
H253-W555
-
AA Sequence
HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW
-
Protein Length
Partial
-
Molecular Weight
40.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAMTS14 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 14) is a member of the ADAMTS family, which plays a significant role in extracellular matrix remodeling and regulation of various biological processes. Research on ADAMTS14 has gained traction due to its implications in several pathological conditions, including osteoarthritis and intervertebral disc degeneration, where it is believed to influence the degradation of cartilage and extracellular matrix components. In addition to its role in tissue homeostasis, ADAMTS14 has been linked to inflammatory responses and cellular signaling pathways. The recombinant expression of ADAMTS14 protein allows for detailed studies on its enzymatic activity, substrate specificity, and regulatory mechanisms, thus providing insights into its functional roles in health and disease. By producing this protein in a controlled manner, researchers can explore its interactions with other matrix proteins and elucidate its potential as a therapeutic target. Understanding the structure-function relationship of ADAMTS14 at the molecular level may contribute to the development of novel treatments for diseases associated with extracellular matrix dysregulation. This research holds promise not only for advancing our comprehension of matrix biology but also for leveraging ADAMTS14 as a biomarker or therapeutic agent in related clinical applications.
