Analytical Data
-
Gene name
Thrombospondin-2
-
简介
Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Application
-
Alternative Names
Thbs2; Tsp2; Thrombospondin-2
-
Species
Mouse
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03350
-
Expression Region
G19-A232
-
AA Sequence
GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Thrombospondin-2 (TSP-2) is a naturally occurring glycoprotein that plays a significant role in various biological processes, including cell adhesion, migration, and the regulation of angiogenesis. It is part of the thrombospondin family, which consists of proteins known for their ability to influence extracellular matrix (ECM) dynamics and modulate cellular responses to environmental cues. Research has highlighted TSP-2's critical function in wound healing, tissue repair, and the maintenance of cardiovascular health. Moreover, alterations in TSP-2 expression or function have been implicated in various pathological conditions, including cancer, cardiovascular diseases, and fibrotic disorders. Given its pivotal roles, TSP-2 has emerged as a promising target for therapeutic interventions. The development of recombinant TSP-2 proteins allows for the exploration of its biological activities in vitro and in vivo, providing insights into its mechanisms of action and potential therapeutic applications. Understanding TSP-2's structural and functional properties through recombinant technology can pave the way for novel strategies aimed at modulating its activity in disease contexts. Moreover, these studies contribute to the broader field of ECM research, underscoring the importance of TSP-2 in maintaining tissue homeostasis and its potential utility in regenerative medicine and targeted therapies.
