Analytical Data
-
Gene name
STAT6
-
简介
STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Signal Transducer and Activator of Transcription 6; IL-4 Stat; STAT6
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P42226
-
Expression Region
S627-S837
-
AA Sequence
SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS
-
Protein Length
Partial
-
Molecular Weight
30.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of STAT6 recombinant protein has gained significant attention due to its crucial role in immune regulation and various pathological conditions. Signal Transducer and Activator of Transcription 6 (STAT6) is a key signaling molecule involved in the response to interleukin-4 (IL-4) and interleukin-13 (IL-13), which are pivotal cytokines in the Th2 immune response. Abnormal STAT6 signaling is implicated in numerous diseases, including allergies, asthma, and certain types of cancer. The recombinant form of STAT6 allows researchers to explore its functional mechanisms, enabling the investigation of its role in transcription regulation and immune system modulation. By producing STAT6 as a recombinant protein, scientists can facilitate various biochemical assays, including binding studies, structural analyses, and cellular signaling experiments, which can provide deeper insights into its interactions with other proteins and its downstream effects. Additionally, understanding the molecular dynamics of STAT6 can contribute to the development of targeted therapeutic strategies aimed at modulating its activity in disease contexts, highlighting the importance of recombinant proteins in advancing biomedical research and therapeutic applications.











