Cat: IPD-X24860

Recombinant Human STAT6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STAT6

  • 简介

    STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Signal Transducer and Activator of Transcription 6; IL-4 Stat; STAT6

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P42226

  • Expression Region

    S627-S837

  • AA Sequence

    SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS

  • Protein Length

    Partial

  • Molecular Weight

    30.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of STAT6 recombinant protein has gained significant attention due to its crucial role in immune regulation and various pathological conditions. Signal Transducer and Activator of Transcription 6 (STAT6) is a key signaling molecule involved in the response to interleukin-4 (IL-4) and interleukin-13 (IL-13), which are pivotal cytokines in the Th2 immune response. Abnormal STAT6 signaling is implicated in numerous diseases, including allergies, asthma, and certain types of cancer. The recombinant form of STAT6 allows researchers to explore its functional mechanisms, enabling the investigation of its role in transcription regulation and immune system modulation. By producing STAT6 as a recombinant protein, scientists can facilitate various biochemical assays, including binding studies, structural analyses, and cellular signaling experiments, which can provide deeper insights into its interactions with other proteins and its downstream effects. Additionally, understanding the molecular dynamics of STAT6 can contribute to the development of targeted therapeutic strategies aimed at modulating its activity in disease contexts, highlighting the importance of recombinant proteins in advancing biomedical research and therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US