Analytical Data
-
Gene name
Desmin/DES
-
简介
Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuDesmin/DES, His; Desmin; DES
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17661
-
Expression Region
V261-L470
-
AA Sequence
VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
-
Protein Length
Partial
-
Molecular Weight
29.72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Desmin (DES) is a type III intermediate filament protein primarily expressed in muscle tissue, playing a crucial role in maintaining the structural integrity and organization of muscle cells. Abnormalities in desmin can lead to various myopathies, particularly desmin-related myopathy (DRM), which is characterized by the progressive degeneration of skeletal and cardiac muscle. Research on recombinant desmin has gained significant attention due to its potential applications in understanding muscle diseases and developing therapeutic strategies. Scientists have been utilizing recombinant DNA technology to produce functional desmin proteins that can be studied in vitro and in vivo. This approach allows for the investigation of desmin's role in muscle cell differentiation, its interactions with other cytoskeletal proteins, and the molecular mechanisms underlying desminopathies. Additionally, recombinant desmin can serve as a valuable tool for drug screening and regenerative medicine applications, aiding in the design of novel treatments for muscle-related disorders. Overall, the study of recombinant desmin is essential for elucidating the pathophysiology of muscle diseases and advancing therapeutic interventions.











