Cat: IPD-X37435

Recombinant Human HGPRT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HGPRT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    (HGPRT)(HGPRTase)

  • Species

    Human

  • Source

    E. coli

  • Tag

    N- His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00492

  • Expression Region

    MHHHHHHKETWWETWWTEWSQPKKKRKVGIGEVLHELADDLPELQSWIKAAQQLGGGGSGFLGPAPAPAPAPA+2-218aa

  • Molecular Weight

    32.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) is a crucial enzyme in the purine salvage pathway, which recycles purine bases for nucleotide synthesis. Deficiency in HGPRT can lead to the x-linked genetic disorder known as Lesch-Nyhan syndrome, characterized by neurological dysfunction and self-aggressive behaviors. Understanding the structure and function of HGPRT is essential for developing targeted therapies for this condition. Research on recombinant HGPRT proteins has gained traction, as these proteins can be produced in vitro for functional studies and therapeutic applications. Advances in recombinant DNA technology allow researchers to express and purify HGPRT from various host systems, such as bacteria or yeast, facilitating detailed biochemical and structural analyses. These studies aim to elucidate the enzyme's catalytic mechanisms, substrate specificity, and interactions with inhibitors. Furthermore, HGPRT's potential role as a drug target is being explored, as modulating its activity may offer novel therapeutic avenues for treating purine metabolism disorders. Overall, the investigation of recombinant HGPRT not only enhances our understanding of purine metabolism but also opens up possibilities for innovative treatments for related genetic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US