Analytical Data
-
Gene name
MKK6
-
简介
The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells, with N-6*His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using Hep3B cells. The ED50 for this effect is 77.27 ng/mL, corresponding to a specific activity is 1.29×104 units/mg. Measured in a cell proliferation assay using Hep3B cells. The ED50 for this effect is 77.27 ng/mL, corresponding to a specific activity is 1.29×104 units/mg.
-
Alternative Names
MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3
-
Species
Human
-
Source
Baculovirus
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52564-1
-
Expression Region
M1-D334, S207D, T211D
-
AA Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MKK6, or Mitogen-Activated Protein Kinase Kinase 6, is a pivotal component of the MAPK signaling cascade, which plays a crucial role in cellular responses to various extracellular stimuli, including growth factors, stress, and inflammatory signals. The study of MKK6 has garnered significant attention due to its involvement in regulating key physiological processes such as cell proliferation, differentiation, and apoptosis. Dysregulation of MKK6 and its downstream effectors, particularly the p38 MAPK pathway, has been implicated in various diseases, including cancer and inflammatory disorders. Researchers aim to understand the precise mechanisms through which MKK6 influences cellular functions and its potential as a therapeutic target. Recombinant MKK6 protein is essential for these studies, as it allows scientists to examine the protein's biochemical properties, interactions, and effects in a controlled environment. By expressing and purifying MKK6 using advanced recombinant techniques, researchers can explore its structure-function relationships, identify novel regulatory mechanisms, and develop inhibitors that could modulate its activity. This line of research not only enhances our understanding of the MAPK signaling network but also contributes to the development of innovative strategies for managing diseases linked to MKK6 dysregulation. Ultimately, the detailed study of recombinant MKK6 is expected to facilitate the advancement of therapeutic applications aimed at restoring normal signaling pathways in various pathological conditions.











