Analytical Data
-
Gene name
TPSB2
- Application
-
Alternative Names
Tryptase Beta-2; Tryptase-2; Tryptase II; TPSB2; TPS2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH29356.1
-
Expression Region
A19-P275
-
AA Sequence
APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
-
Protein Length
Partial
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPSB2, or Tryptase Beta-2, is a serine protease predominantly expressed in human mast cells. It plays a crucial role in inflammation and immune responses, contributing to various physiological and pathological processes. Dysregulation of TPSB2 has been implicated in several diseases, including asthma, allergic reactions, and certain cancers. Research on TPSB2 has garnered significant attention due to its potential as a biomarker for mast cell-related disorders and its involvement in chronic inflammatory conditions. The study of recombinant TPSB2 protein enables researchers to investigate its biological functions and enzymatic activity in detail, providing insights into its mechanism of action. Moreover, understanding the interactions of TPSB2 with other proteins and cells can shed light on its role in the immune system. The expression and purification of recombinant TPSB2 are critical for developing therapeutic strategies targeting mast cell activation and for designing specific inhibitors that could mitigate the effects of excessive inflammation mediated by this protease. Consequently, TPSB2 serves as a valuable model for studying mast cell biology and developing targeted treatments for allergic diseases and related conditions.











