Analytical Data
-
Gene name
RecR
-
简介
RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Application
-
Alternative Names
recR; b0472; JW0461; Recombination protein RecR
-
Species
E.coli
-
Source
E. coli
-
Tag
N-SUMO;N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A7H6
-
Expression Region
M1-F201
-
AA Sequence
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF
-
Protein Length
Full Length
-
Molecular Weight
38.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RecR is a crucial protein involved in homologous recombination, a vital process for DNA repair and genetic diversity in prokaryotes. It plays a significant role in ensuring the accurate repair of DNA double-strand breaks, which can arise from various sources such as environmental stresses, replication errors, or radiation damage. The RecR protein functions as a single-stranded DNA (ssDNA) binding protein, facilitating the assembly of the recombinase complex that includes other key proteins, such as RecA. Understanding the biochemical properties and mechanisms of RecR is essential for elucidating the recombination process at a molecular level. Furthermore, investigations into the structure and function of RecR can reveal insights into the broader implications of genome stability, potential evolutionary adaptations, and the development of novel antimicrobial strategies. Given its importance, RecR has garnered attention in microbiological and genetic research, making it a relevant subject for developing plasmid-based gene transfer techniques and synthetic biology applications. The ongoing studies of RecR and its interactions with other recombination proteins continue to enhance our understanding of genetic repair pathways and their evolutionary significance across different organisms.











