Cat: IPD-X24663

Recombinant E.coli RecR Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RecR

  • 简介

    RecR protein potentially plays a vital role in DNA repair, especially in RecBC-independent recombinational processes. It collaborates with RecF and RecO, suggesting its involvement in cooperative interactions within the cellular machinery dedicated to DNA repair. Further investigation is needed to elucidate RecR's precise functions and molecular interactions in maintaining genomic integrity through DNA repair. RecR Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecR protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    recR; b0472; JW0461; Recombination protein RecR

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    N-SUMO;N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A7H6

  • Expression Region

    M1-F201

  • AA Sequence

    MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF

  • Protein Length

    Full Length

  • Molecular Weight

    38.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RecR is a crucial protein involved in homologous recombination, a vital process for DNA repair and genetic diversity in prokaryotes. It plays a significant role in ensuring the accurate repair of DNA double-strand breaks, which can arise from various sources such as environmental stresses, replication errors, or radiation damage. The RecR protein functions as a single-stranded DNA (ssDNA) binding protein, facilitating the assembly of the recombinase complex that includes other key proteins, such as RecA. Understanding the biochemical properties and mechanisms of RecR is essential for elucidating the recombination process at a molecular level. Furthermore, investigations into the structure and function of RecR can reveal insights into the broader implications of genome stability, potential evolutionary adaptations, and the development of novel antimicrobial strategies. Given its importance, RecR has garnered attention in microbiological and genetic research, making it a relevant subject for developing plasmid-based gene transfer techniques and synthetic biology applications. The ongoing studies of RecR and its interactions with other recombination proteins continue to enhance our understanding of genetic repair pathways and their evolutionary significance across different organisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US