Analytical Data
-
Gene name
Wee1
-
简介
Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.
- Application
-
Alternative Names
WEE1; Wee1-like protein kinase; WEE1hu; Wee1A kinase
-
Species
Human
-
Source
Baculovirus
-
Tag
N-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30291
-
Expression Region
M291-K575
-
AA Sequence
MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK
-
Protein Length
Partial
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Wee1 is a crucial regulatory protein that plays a significant role in the cell cycle, specifically in controlling the transition from the G2 phase to mitosis. It functions as a tyrosine kinase that phosphorylates and inhibits Cyclin-dependent kinase 1 (CDK1), thereby preventing premature entry into mitosis and ensuring proper DNA damage response. Research into Wee1 has gained momentum due to its implications in cancer biology; many cancer cells exploit the G2/M checkpoint to enhance their survival and proliferation in the presence of DNA damage. Consequently, Wee1 has emerged as a promising therapeutic target, particularly in the context of exploiting the vulnerabilities of cancer cells with deficiencies in other DNA damage repair pathways. The development of Wee1 inhibitors, such as MK-1775, is currently under investigation in clinical trials to assess their efficacy in enhancing the sensitivity of cancer cells to chemotherapeutic agents and radiation therapy. Understanding the structure, function, and regulation of Wee1, as well as its interactions with other cell cycle regulators, is critical for the design of effective cancer treatments and for overcoming resistance to existing therapies. Overall, the study of Wee1 and its reconstitution as a recombinant protein provides valuable insights into cell cycle regulation and opens avenues for targeted cancer therapies.











